Protein Info for SO3541 in Shewanella oneidensis MR-1

Annotation: sodium:alanine symporter family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 62 to 88 (27 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 248 to 258 (11 residues), see Phobius details amino acids 301 to 323 (23 residues), see Phobius details amino acids 346 to 367 (22 residues), see Phobius details amino acids 387 to 410 (24 residues), see Phobius details amino acids 415 to 437 (23 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 14 to 440 (427 residues), 493.1 bits, see alignment E=3.3e-152 PF01235: Na_Ala_symp" amino acids 51 to 452 (402 residues), 520.1 bits, see alignment E=2.4e-160

Best Hits

Swiss-Prot: 48% identical to ALST_BACSU: Amino-acid carrier protein AlsT (alsT) from Bacillus subtilis (strain 168)

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 100% identity to son:SO_3541)

Predicted SEED Role

"Na(+)-linked D-alanine glycine permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBH5 at UniProt or InterPro

Protein Sequence (488 amino acids)

>SO3541 sodium:alanine symporter family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MLETIVNFLNALLWGKLLVYGLVGAGLYFTLRLVFIQLTHFKHSLKIMTMSRQGCESGLS
SFQVFCTSMAARVGAGNMAGVAVAIGAAGPGAVFWMWLIAMLGMATAMVESTLAQVYKVR
DANGQFRGGPSYYMEKGLGQRWMGVLFAFFLIIAFGLVFNAVQANTITGAMERVFGFDPT
YVGIGLVLASGFVIMGGLRKVARVSEFIVPIMALAYILIAFIIVLFNLEQLPAVISLIVK
SAFGWQEAAAGGVAYTVAQAMQAGIARGLFSNEAGMGSAANVAASASPNPNHPASQGFVQ
MMGVFVDTIVICTATAAIILLSGDIGSSDDGIRLTINAMSNHVGDWGGAFIAVAIFLFCF
TSIIANYSYAETNVMFLTGNSTKALPLFRLCVLGMVMFGSVAKISLVWNLADVSMGLMAT
VNIVALLLLSGLAIRVINDYCDQLKSGKMPEFDRSKFPELMEQLDDGIWQDNSVNELAKA
PSESAISR