Protein Info for SO3540 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF03883: H2O2_YaaD" amino acids 1 to 243 (243 residues), 308.7 bits, see alignment E=2.8e-96 PF21818: DUF6884" amino acids 98 to 182 (85 residues), 30.1 bits, see alignment E=5.1e-11

Best Hits

Swiss-Prot: 100% identical to Y3540_SHEON: UPF0246 protein SO_3540 (SO_3540) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K09861, hypothetical protein (inferred from 100% identity to son:SO_3540)

Predicted SEED Role

"UPF0246 protein YaaA" in subsystem YaaA

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBH6 at UniProt or InterPro

Protein Sequence (257 amino acids)

>SO3540 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MLILVSPAKTLDFEQPPLTQIHTRPDFLAQSQELIQVCQQLTPSDIATLMKVSDSIAGLN
AARFGEWKPDYSIDNAKQAIFAFRGDVYTGFDADTLTAAQLERTQSQLRILSGLYGLLRP
LDLILPYRLEMGTALTNQKGKNLYEFWGNTLTDAVNSAVAAQGDGIIINLASNEYFKAIK
PKFLNGQLITPVFKDFKNGQYKVISFFAKRARGMMARYIIDQQVSSIDGLKAFEVDGYYY
SEELSKPNEPTFLREAQ