Protein Info for SO3530 in Shewanella oneidensis MR-1

Name: fkbP-2
Annotation: peptidyl-prolyl cis-trans isomerase FkbP (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 PF00254: FKBP_C" amino acids 7 to 71 (65 residues), 30.5 bits, see alignment E=1.9e-11

Best Hits

Swiss-Prot: 46% identical to FKBX_ECOLI: FKBP-type 16 kDa peptidyl-prolyl cis-trans isomerase (fkpB) from Escherichia coli (strain K12)

KEGG orthology group: K03774, FKBP-type peptidyl-prolyl cis-trans isomerase SlpA [EC: 5.2.1.8] (inferred from 100% identity to son:SO_3530)

MetaCyc: 46% identical to peptidyl-prolyl cis-trans isomerase FkpB (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]

Predicted SEED Role

"FKBP-type peptidyl-prolyl cis-trans isomerase SlpA (EC 5.2.1.8)" (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBI6 at UniProt or InterPro

Protein Sequence (139 amino acids)

>SO3530 peptidyl-prolyl cis-trans isomerase FkbP (NCBI ptt file) (Shewanella oneidensis MR-1)
MTVTRSLVCHMNIVLEDGSTADSTASGKPARLNIGDGTLSPAFEAQLVSLNEGDKHSFTL
EAVDAFGESNPDAIHYMDRTRFPADMALEVGVIVSFAGPGGSEIPGIVREVAGDSITVDL
NHPLAGRKVTFELDVVKVL