Protein Info for SO3514 in Shewanella oneidensis MR-1

Annotation: hypothetical TonB-dependent receptor (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 874 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR01782: TonB-dependent receptor" amino acids 43 to 874 (832 residues), 686.4 bits, see alignment E=3.5e-210 PF07715: Plug" amino acids 62 to 171 (110 residues), 56.6 bits, see alignment E=5.3e-19 PF00593: TonB_dep_Rec" amino acids 400 to 829 (430 residues), 123.5 bits, see alignment E=3.3e-39 PF14905: OMP_b-brl_3" amino acids 520 to 834 (315 residues), 37.6 bits, see alignment E=2.1e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_3514)

Predicted SEED Role

"N-acetylglucosamine-regulated TonB-dependent outer membrane receptor" in subsystem Chitin and N-acetylglucosamine utilization or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBK0 at UniProt or InterPro

Protein Sequence (874 amino acids)

>SO3514 hypothetical TonB-dependent receptor (NCBI ptt file) (Shewanella oneidensis MR-1)
MRPSSFKKSVLATNIAILLGSAVSISAVAAEAEATAAAPENIEKIEVRGMRASMKASVND
KRFSDSVVDAVTAEDIGKFPDGDVGESLARIPGVAVNRQFGQGQQVSIRGASNQLTRTLL
NGHTVASTGWFDQQAIDRSFNYSLLPPELVGGILVNKSSQADIAEGGVGGTITVKTRKPL
DLEANSLFLSAKGDYGTVSEEIDPQTSGLYSWKDDDEKFGFLLAGSLDKTQYQRNGIETL
LGWGEIVPTTFQQDRERTAINAAFQYRPTDALEFGLNVMSLQLDADNANTSIFLFPTQQG
ENKCIQKNAAGVCTLIEHTGKGGFAWAQTWARKASMSSDTVDLDFAYQAEDYKLEGRIGK
TKAEGGTDLTSNYGQSIGKPGDFAGIYDATGDVIKIDIANNSFDASDFNDKLETAGWALK
KQPNTDEEAFATFDITVPVEFGVITSIKSGLSYADHEVTQTTEKAIVSNVMAKNASEYYS
GTISSGAGFTLPKPIFDNMIRDAYAAIDGFTLDKSGYGTLQEKNLALYTMATFAGEGVRG
NFGLRYISTDIESDYYALNNKGVYADDLSTDKASYNDVLPSMNIAFDLASDVILRASAAQ
VISRPNYADLFATNRLPGFDDGTPNNEKKVIGNVALLPFKASQADLGVEWYFSSEGLFAA
TYFIKDVSSFISTKETLKQQIGIEDPNLIKEGVSSCGVGVYDCWTVTEYFNATGGSIDGI
ELQLQDAFDNGLGYLVNYTFADASSPAENYADRVGVFSDSSKHTVNLVGYYEMDDFSVRA
AYNWRSEYMMRELPGFYGNREHQAYGTVDLSANYNVTDYLSVTFEVVNLFEEDSIQKGVA
PLDAKGVISEFKADYPVWSFEGEARYQLGMALRF