Protein Info for SO3513 in Shewanella oneidensis MR-1

Annotation: tryptophan halogenase, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF04820: Trp_halogenase" amino acids 5 to 467 (463 residues), 501 bits, see alignment E=1.7e-154

Best Hits

KEGG orthology group: K14266, FADH2 O2-dependent halogenase I [EC: 1.14.14.7] (inferred from 100% identity to son:SO_3513)

Predicted SEED Role

"Tryptophan halogenase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.14.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBK1 at UniProt or InterPro

Protein Sequence (507 amino acids)

>SO3513 tryptophan halogenase, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MTIRKIAIIGGGTSGWLAANHLGRALKGRSGLSISVIESPDIPIIGVGEGTVPSIRKSLQ
SFGISESEFIRTCDVTFKQSIKFVNWLDKTRHGKHNFYHHLFDIINLHQGDAVSAWLAEQ
SGHFADFVSTQHLACEVAKAPKLITTPEYAGVLGYAYHLNAAKFAKLLAKNAIEKFNVEH
ILTTVHDVCLGVDGAIESLQTEQGNLSFDFYIDCSGFESILLAKALKVPFISKAQQLFID
TALVAQIPTQPADVIPPYTKATAHQAGWIWDIALTQRRGTGFVYSSAHMNQAEAERKFDH
YLGGKLADIPHRKIPMTVGYRQQFWVKNCVALGLAQGFLEPIEATSILLTDFSARFLAER
FPANIDDVDYLAKRFNDTVGYAWERVVEFAKLHYCLSDRTDSAFWLDNQREETISEPLKE
RLNMWKSFSPIAEDFPSKFEVFNLDNYLYVLYGMKYPTQPHDRGLVAKANLNAYMSNMSN
VKRQMLEGLPEHRELIDKICTYGLQPI