Protein Info for SO3506 in Shewanella oneidensis MR-1

Updated annotation (from data): Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6)
Rationale: Specifically important for utilizing N-Acetyl-D-Glucosamine. Automated validation from mutant phenotype: the predicted function (GLUCOSAMINE-6-P-DEAMIN-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: SIS domain protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF01380: SIS" amino acids 43 to 165 (123 residues), 63.6 bits, see alignment E=8.2e-22 amino acids 201 to 284 (84 residues), 35 bits, see alignment E=5.8e-13

Best Hits

KEGG orthology group: K00820, glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC: 2.6.1.16] (inferred from 100% identity to son:SO_3506)

Predicted SEED Role

"Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6)" in subsystem Chitin and N-acetylglucosamine utilization or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.99.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.16

Use Curated BLAST to search for 2.6.1.16 or 3.5.99.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBK7 at UniProt or InterPro

Protein Sequence (332 amino acids)

>SO3506 Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6) (Shewanella oneidensis MR-1)
MTNTIMEQEARTAPQKIAGQLAANADLMQQLGEKLRAFDPRFVMIVGRGSSDHAGVFAKY
LFEIEVGVPTFAAAPSVASVYGKTLKLEGGLVIVISQSGRSPDILAQARMAKNAGAFCVA
LVNDETAPIKDIVDVVVPLRAGEEKAVAATKSYLATLSAILQLASAWTQSESLAAAVSSL
PQALQTAVVAEPQLTPESVENVKNLVVLGRGLGYAVSKEIALKLKEVCSIHAEAFSSAEF
LHGPVTLVEKKLTIVDVCIGDESYASHIEQIENVSQRGADLVHLNQTSTDIHPRVAPLAL
LQRFYIDVAAVAIARGIDPDQPAGLKKVTQTL