Protein Info for SO3493 in Shewanella oneidensis MR-1

Name: mexE
Annotation: RND multidrug efflux membrane fusion protein MexE (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 103 to 436 (334 residues), 254.3 bits, see alignment E=7.3e-80 PF25917: BSH_RND" amino acids 128 to 264 (137 residues), 62.3 bits, see alignment E=9.7e-21 PF25973: BSH_CzcB" amino acids 129 to 266 (138 residues), 34.2 bits, see alignment E=5.7e-12 PF25876: HH_MFP_RND" amino acids 169 to 237 (69 residues), 36.3 bits, see alignment E=1.7e-12 PF25944: Beta-barrel_RND" amino acids 299 to 359 (61 residues), 43 bits, see alignment E=1.5e-14 PF25954: Beta-barrel_RND_2" amino acids 310 to 363 (54 residues), 24.9 bits, see alignment 5.7e-09 PF25967: RND-MFP_C" amino acids 369 to 428 (60 residues), 34.1 bits, see alignment E=6.6e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_3493)

Predicted SEED Role

"RND multidrug efflux membrane fusion protein MexE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBL8 at UniProt or InterPro

Protein Sequence (476 amino acids)

>SO3493 RND multidrug efflux membrane fusion protein MexE (NCBI ptt file) (Shewanella oneidensis MR-1)
MFIKLSQNITYSSVQNLLTGSFYNIYYRSVHNIFYQSVFIDFDRVPISDVCLKRDKCLPH
EDCKMISNPTLRTLMLTTVAAFVLSACGEPEVLQGQAPAAPKVDVAQVLQERVTEWDEFT
GRLQAPESVTLVPRVSGYIASVNFKEGALVKKGDVLFRIDASVFEAEVARLKADLASALS
ADQLATNDLERARKLFVQKAVSAELLDTRESNKRQTTAAVASVKAALLRAELDLDYTQVR
APIDGRASYANVTAGNYVSAGQSVLTHLVSTASMYAYFDVDEQTYLKYVKLTAEKKRNDP
RAGDNPVYMALANEREYQHVGIVDFVDNAMDRQTGTIRVRATFSNEDNSLLPGLFARLRT
AGSSAYDGILIDDKAVGTDLNNKFVLVVANDGTVEYRGVTLGEKVQGLRIVKQGLAANDK
IVVNGMQRVRPKMQIEPLLVDMADSEQLEALRHAQLMLDKNQENLTTQAVEVASRG