Protein Info for SO3483 in Shewanella oneidensis MR-1

Annotation: HlyD family secretion protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 42 to 346 (305 residues), 284.7 bits, see alignment E=3.9e-89 PF25917: BSH_RND" amino acids 65 to 188 (124 residues), 45.8 bits, see alignment E=1.1e-15 PF25954: Beta-barrel_RND_2" amino acids 199 to 270 (72 residues), 67.2 bits, see alignment E=3.1e-22 PF25967: RND-MFP_C" amino acids 279 to 335 (57 residues), 35.7 bits, see alignment E=1.7e-12 PF25989: YknX_C" amino acids 280 to 345 (66 residues), 48.9 bits, see alignment E=1.2e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_3483)

MetaCyc: 56% identical to vibriobactin efflux pump periplasmic adaptor protein (Vibrio cholerae O1 biovar El Tor str. N16961)
TRANS-RXN-502

Predicted SEED Role

"Membrane fusion protein of RND family multidrug efflux pump" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBM7 at UniProt or InterPro

Protein Sequence (369 amino acids)

>SO3483 HlyD family secretion protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKKTIIAIALIATVATAVSFSDVLQAAKPESAPQPMRTVPVVTGEVVEHPLAQSVSLIGK
LAADRAVVIAPQVTGKIKQIAVVSNQAVKKGQLLIELDDMKAQAAVAEANAFLNDETRKL
KEFEKLISRNAITQTEIDAQKASVDIARARLASAQADLHYHSLIAPFAGQTGLINFSEGK
MVSTGNELMTLDDLSSMRLDLQVPEHFLSQISIGMPVSSTSRAWPGETFIGKVVAIDPRV
NEETLNLKIRVQFENTDNRLKPGMMMSSTITFPPISAPIVPVQALEYSGTKRYVYVVGED
HIAHRTEVILGARVGDQVLIDSGLKIGDKVVVQGLVNMRDGLKINEVALEAKNSNNRPAK
SDVNTAETK