Protein Info for SO3464 in Shewanella oneidensis MR-1

Name: thiL
Annotation: thiamin-monophosphate kinase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01379: thiamine-phosphate kinase
  • amino acids 2 to 318 (317 residues), 356.9 bits, E=4.3e-111
• PF00586: AIRS
  • amino acids 26 to 136 (111 residues), 111 bits, E=4.2e-36
• PF02769: AIRS_C
  • amino acids 148 to 303 (156 residues), 38.6 bits, E=1.3e-13

Best Hits

Swiss-Prot: 60% identical to THIL_ECOL6: Thiamine-monophosphate kinase (thiL) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00946, thiamine-monophosphate kinase [EC: 2.7.4.16] (inferred from 100% identity to son:SO_3464)

MetaCyc: 60% identical to thiamine monophosphate kinase (Escherichia coli K-12 substr. MG1655)
Thiamine-phosphate kinase. [EC: 2.7.4.16]

Predicted SEED Role

"Thiamine-monophosphate kinase (EC 2.7.4.16)" in subsystem Thiamin biosynthesis (EC 2.7.4.16)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (10/10 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• thiamine diphosphate salvage V (2/3 steps found)
• thiamine diphosphate salvage I (1/2 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.16

Sequence Analysis Tools

See Q8EBP5 at UniProt or InterPro

Protein Sequence (318 amino acids)

>SO3464 thiamin-monophosphate kinase (NCBI ptt file) (Shewanella oneidensis MR-1)
MKEFQLIECYFNHRGPTRRDVKLSIGDDCALVQPAENKSIAISCDTLVENVHFFPDIPPQ
ALGYKALAVNLSDLAAMGAEPAWMTLALTLPEVNETWLSGFSEGLFEAADYYGIALIGGD
TTRGPRAINITVHGQVPQGKALTRHGAKAGDWIYVTGTLGDSALGLDLIRCVQHARAEHK
EFLINRHYRPTPRVLAGQSLRSLASSAIDLSDGFISDIGHILKASKVGAVVDVGAIPLSR
AMQDTVSEEHALGYALTGGEDYELLFTVPEAQKGALETALSHAGTKFVRVGQICAGSKLK
LQLNGELFTPPYHGFEHF