Protein Info for SO3461 in Shewanella oneidensis MR-1

Updated annotation (from data): Fatty acid transporter
Rationale: Specific phenotype on Tween-20, which is hydrolyzed extracellularly to fatty acids (typically around 12 carbons). This protein is distantly related (PF03547) to auxin efflux transporters in plants and to the malate permease mleT of Lactobacillus casei (PMID: 23835171)
Original annotation: transporter, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 62 to 86 (25 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 157 to 185 (29 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details amino acids 229 to 253 (25 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 292 to 311 (20 residues), see Phobius details PF03547: Mem_trans" amino acids 3 to 310 (308 residues), 117.4 bits, see alignment E=2.7e-38

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 100% identity to son:SO_3461)

Predicted SEED Role

"TRANSPORTER"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBP8 at UniProt or InterPro

Protein Sequence (319 amino acids)

>SO3461 Fatty acid transporter (Shewanella oneidensis MR-1)
MTILTPLFAVFGIMLLGTLVQKLRFLPVETDQVLNQYVYYIAFPAVLLIALAQQPIEEIL
QWRFIAGYSAAMLVIYLMCIGISLLVNPKQHAIAAVRALNATFGNTAFIGIPLLVIIFPE
QQSALVAAIASLLSVLMFAVALVSLELTTNKHRQHHAVVIMCLAITKNPIVIGCFIGISI
SALGITLPSGVALMIQQIGNTSSPCALFAVGMVLAKAMRYQKDSKLFSLTNFVELCLINL
FKLILQPALVFFMLKSIGVTGDYLVMGVILSALPTAASVYLLAQRYNTQASTCAQGILFG
TIVTFFSLPILEQLVKTYS