Protein Info for SO3456 in Shewanella oneidensis MR-1

Annotation: RNA methyltransferase, TrmA family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01938: TRAM
  • amino acids 23 to 69 (47 residues), 35.9 bits, 1.9e-12
• TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA
  • amino acids 26 to 440 (415 residues), 389.2 bits, E=1.2e-120
• PF05958: tRNA_U5-meth_tr
  • amino acids 101 to 444 (344 residues), 80.5 bits, E=4.6e-26
• PF01135: PCMT
  • amino acids 289 to 359 (71 residues), 29.8 bits, E=1.8e-10
• PF02475: Met_10
  • amino acids 302 to 353 (52 residues), 22.3 bits, 3.5e-08
• PF13847: Methyltransf_31
  • amino acids 303 to 394 (92 residues), 48.7 bits, E=2.6e-16
• PF13649: Methyltransf_25
  • amino acids 307 to 362 (56 residues), 38.9 bits, 4.1e-13
• PF08241: Methyltransf_11
  • amino acids 308 to 361 (54 residues), 25.7 bits, 5.1e-09

Best Hits

Swiss-Prot: 100% identical to RLMD_SHEON: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 100% identity to son:SO_3456)

Predicted SEED Role

"23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See Q8EBQ3 at UniProt or InterPro

Protein Sequence (449 amino acids)

>SO3456 RNA methyltransferase, TrmA family (NCBI ptt file) (Shewanella oneidensis MR-1)
MAQFFKAKPNSSKQLSAKQSFSVQQLDHLGAGIAQHQGKVVFIPGALPNETVQAQLTEQK
KNYARAKLIKVETPSTERVSPLCPHYHTCGGCDLQHMSLTAQREHKSAALVDIMAKFAGA
EGSLAPALSGEGWHYRRRARLATLFDKNTKQLSLGFRASSSSHVVSITECLVLAKPLSDL
IAPFAKLLNQLAAKSSLGHLELIAADNGHFAVIRITKSLNDKDMAKLAQFAEQHQIHICL
QDNEGEFHGVNGTLLLPVYQLLDDKTDVQPVSLTFTPGNFVQVNAQINKAMVAQALDWLA
PQPGERILDLFCGMGNFSLPLARMGADVIGVEGVPEMVSQARENAVANGLSNLTFYHGDL
SADLSSEPWMGKIDKLLLDPARAGAYESLQWLKKMKPRQVVYVSCNPASLARDSAVLLER
GYKLQKLGLIDMFPQTHHIEAMALFELAK