Protein Info for SO3440 in Shewanella oneidensis MR-1
Name: eno
Annotation: enolase (NCBI ptt file)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to ENO_SHEON: Enolase (eno) from Shewanella oneidensis (strain MR-1)
KEGG orthology group: K01689, enolase [EC: 4.2.1.11] (inferred from 100% identity to son:SO_3440)MetaCyc: 83% identical to enolase (Escherichia coli K-12 substr. MG1655)
Phosphopyruvate hydratase. [EC: 4.2.1.11]
Predicted SEED Role
"Enolase (EC 4.2.1.11)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Serine-glyoxylate cycle (EC 4.2.1.11)
MetaCyc Pathways
- superpathway of chorismate metabolism (50/59 steps found)
- superpathway of aromatic amino acid biosynthesis (18/18 steps found)
- gluconeogenesis I (13/13 steps found)
- superpathway of L-tryptophan biosynthesis (13/13 steps found)
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
- Bifidobacterium shunt (14/15 steps found)
- superpathway of L-phenylalanine biosynthesis (10/10 steps found)
- superpathway of L-tyrosine biosynthesis (10/10 steps found)
- superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (21/26 steps found)
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
- heterolactic fermentation (15/18 steps found)
- chorismate biosynthesis I (7/7 steps found)
- Rubisco shunt (9/10 steps found)
- superpathway of glucose and xylose degradation (14/17 steps found)
- glycolysis I (from glucose 6-phosphate) (11/13 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
- Entner-Doudoroff pathway I (8/9 steps found)
- chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
- glycolysis II (from fructose 6-phosphate) (9/11 steps found)
- glycolysis III (from glucose) (9/11 steps found)
- ethene biosynthesis V (engineered) (19/25 steps found)
- homolactic fermentation (9/12 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
- superpathway of anaerobic sucrose degradation (14/19 steps found)
- superpathway of N-acetylneuraminate degradation (16/22 steps found)
- gallate biosynthesis (2/3 steps found)
- glycolysis IV (7/10 steps found)
- glycolysis V (Pyrococcus) (7/10 steps found)
- chorismate biosynthesis II (archaea) (8/12 steps found)
- gluconeogenesis III (8/12 steps found)
- glycolysis VI (from fructose) (7/11 steps found)
- quinate degradation I (1/3 steps found)
- quinate degradation II (1/3 steps found)
- formaldehyde assimilation I (serine pathway) (8/13 steps found)
- Entner-Doudoroff pathway II (non-phosphorylative) (5/9 steps found)
- Entner-Doudoroff pathway III (semi-phosphorylative) (5/9 steps found)
- glycerol degradation to butanol (10/16 steps found)
- superpathway of hexitol degradation (bacteria) (10/18 steps found)
- gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)
- superpathway of aromatic compound degradation via 3-oxoadipate (5/35 steps found)
- superpathway of aromatic compound degradation via 2-hydroxypentadienoate (4/42 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Glycolysis / Gluconeogenesis
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.2.1.11
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q8EBR0 at UniProt or InterPro
Protein Sequence (398 amino acids)
>SO3440 enolase (NCBI ptt file) (Shewanella oneidensis MR-1) MAAAPSGASTGSREALELRDGDKSRYLGKGVLTAVANVNGPIRTALIGKDATAQAELDQI MIDLDGTENKDKLGANAILAVSLAAAKAAAAFKGMPLYAHIAELNGTPGQYAMPVPMMNI LNGGEHADNNVDIQEFMVQPVGAKNFREALRMGAEIFHTLKKVLHGKGLSTSVGDEGGFA PNLSSNADALAVIKEAVELAGYKLGTDVTLALDCAASEFYKDGKYDLAGEGKVFDSNGFS DFLKSLTEQYPIVSIEDGLDESDWDGWAYQTQIMGDKIQLVGDDLFVTNTKILTRGIENG IANSILIKFNQIGSLTETLAAIRMAKAAGYTAVISHRSGETEDATIADLAVGTAAGQIKT GSLCRSDRVAKYNQLLRIEEQLGEKAPYRGLKEIKGQA