Protein Info for SO3427 in Shewanella oneidensis MR-1

Annotation: aspartokinase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00696: AA_kinase
  • amino acids 11 to 239 (229 residues), 176.9 bits, E=8.7e-56
• TIGR00657: aspartate kinase
  • amino acids 72 to 414 (343 residues), 341 bits, E=6.3e-106
• PF13840: ACT_7
  • amino acids 350 to 410 (61 residues), 32.2 bits, E=1.2e-11
• PF22468: ACT_9
  • amino acids 355 to 413 (59 residues), 49.7 bits, E=3.6e-17

Best Hits

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 100% identity to son:SO_3427)

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• dipicolinate biosynthesis (3/4 steps found)
• L-lysine biosynthesis II (6/9 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• L-methionine biosynthesis IV (2/4 steps found)
• spermidine biosynthesis II (2/4 steps found)
• ectoine biosynthesis (2/5 steps found)
• 3-dehydroquinate biosynthesis II (archaea) (3/7 steps found)
• norspermidine biosynthesis (2/6 steps found)
• cremeomycin biosynthesis (2/7 steps found)
• grixazone biosynthesis (2/8 steps found)
• superpathway of polyamine biosynthesis III (2/8 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.7.2.4

Use Curated BLAST to search for 2.7.2.4

Sequence Analysis Tools

See Q8EBS2 at UniProt or InterPro

Protein Sequence (418 amino acids)

>SO3427 aspartokinase (NCBI ptt file) (Shewanella oneidensis MR-1)
MLEKRKLSGSKLFVKKFGGTSVGSIERIEVVAEQIAKSAHSGEQQVLVLSAMAGETNRLF
ALAAQIDPRASARELDMLVSTGEQISIALMAMALQRRGIKARSLTGDQVQIHTNSQFGRA
SIESVDTAYLTSLLEQGIVPIVAGFQGIDPNGDVTTLGRGGSDTTAVALAAALRADECQI
FTDVSGVFTTDPNIDSSARRLDVIGFDVMLEMAKLGAKVLHPDSVEYAQRFKVPLRVLSS
FEAGQGTLIQFGDESELAMAASVQGIAINKALATLTIEGLFTSSERYQALLACLARLEVD
VEFITPLKLNEISPVESVSFMLAEAKVDILLHELEVLSESLDLGQLIVERQRAKVSLVGK
GLQAKVGLLTKMLDVLGNETIHAKLLSTSESKLSTVIDERDLHKAVRALHHAFELNKV