Protein Info for SO3426 in Shewanella oneidensis MR-1

Name: csrA
Annotation: carbon storage regulator (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 65 PF02599: CsrA" amino acids 1 to 52 (52 residues), 91.6 bits, see alignment E=1.2e-30 TIGR00202: carbon storage regulator" amino acids 1 to 56 (56 residues), 103.8 bits, see alignment E=2e-34

Best Hits

Swiss-Prot: 100% identical to CSRA_SHEPA: Translational regulator CsrA (csrA) from Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)

KEGG orthology group: K03563, carbon storage regulator (inferred from 94% identity to saz:Sama_1050)

Predicted SEED Role

"Carbon storage regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBS3 at UniProt or InterPro

Protein Sequence (65 amino acids)

>SO3426 carbon storage regulator (NCBI ptt file) (Shewanella oneidensis MR-1)
MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQSEKSGTPS
EGGNF