Protein Info for SO3389 in Shewanella oneidensis MR-1

Annotation: sensory box protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 879 PF08448: PAS_4" amino acids 213 to 318 (106 residues), 42.8 bits, see alignment E=2e-14 amino acids 334 to 442 (109 residues), 28.3 bits, see alignment E=6e-10 PF13426: PAS_9" amino acids 215 to 317 (103 residues), 14.4 bits, see alignment E=1.3e-05 amino acids 338 to 439 (102 residues), 67.2 bits, see alignment E=4.8e-22 TIGR00229: PAS domain S-box protein" amino acids 332 to 448 (117 residues), 80 bits, see alignment E=1.6e-26 PF13188: PAS_8" amino acids 333 to 375 (43 residues), 25.4 bits, see alignment 3.5e-09 PF00989: PAS" amino acids 338 to 438 (101 residues), 54.9 bits, see alignment E=3e-18 PF08447: PAS_3" amino acids 350 to 434 (85 residues), 37.2 bits, see alignment E=1e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 448 to 612 (165 residues), 146.9 bits, see alignment E=4.6e-47 PF00990: GGDEF" amino acids 452 to 610 (159 residues), 147.4 bits, see alignment E=1.2e-46 PF00563: EAL" amino acids 631 to 865 (235 residues), 229.2 bits, see alignment E=1.6e-71

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_3389)

Predicted SEED Role

"Sensory box protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBV6 at UniProt or InterPro

Protein Sequence (879 amino acids)

>SO3389 sensory box protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MIDCAISQKQLTDWANDLQLVADITQSYAVILKVNAAGEYRQLIQSELCQQDDIEALIRH
FNHKAHLNLYQNATPKVNTSSTRAAPHNPFNESSTFSQYQVNLPVDVRHAAAYQQALIPD
VKAMPQWRDAGLGSLIYLPIIWSSGAHFGVFCLYHKAALQLDDKALQLASLTVNSLQLNL
SELHRAQRQQMTVLRGDAQSIDIIDLQTFIDSFEEHIWVKNTEGVYTICNQSVEKAWDLP
RSDIVGKTDEDLFGKAIADIFLNGDRLAIEAGAPIIVAECLDGENKNNHLWLETLKLPAL
TPDGELAGVIGMTRNISKHKEVEEQLTLATNVFKHSFEGVVVTDRHGNITDVNGAFYEIT
GYSREELLGQNPRLFNSGRHEKAFFETMWNNLLGGGKWNGEIWNRRKDGTIFPQNITISA
IYDEVGEIRYFVAVFADISAQKQSEAQLAHLAYFDPLTHLPNRMKLMIQLKQEIMHAKRL
NSQLATVFIDVDLFKHINDSFGHSIGDEMLVELAKRLRSQLQEQDVLSRIGSDEFVALIS
GIQYHEDATAAINQLRQVFEQPFVVSTGDHLRLTATMGVSLYPSDGSNADTLLRNADAAM
YRAKSEGRNNYAFYTESLTKESIEHLKLQSALYGALEQNALYLMYQPKVDLVTRKTVGVE
ALLRWNDPILGQISPSVFIPVAEKSGLIYDIGLWVLETACQQGVHWLAAGKQFGRIAVNV
AGQQLQRNSFVEDVKRILTQTGLPATCLELEVTESVMMNNPDVAIRDLKLLGDLGIVLSV
DDFGTGYSSLNYLKKLPIHKLKIDQSFVRDIPFDTNNTAIAKAVIVLGHALKLEIVAEGV
ETAEQADFLTQNLCDQAQGYLFSRPQLPADVEAFFTKLK