Protein Info for SO3371 in Shewanella oneidensis MR-1

Annotation: hypothetical Cytochrome B561 (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 transmembrane" amino acids 9 to 34 (26 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 9 to 178 (170 residues), 117.1 bits, see alignment E=3.9e-38

Best Hits

Swiss-Prot: 48% identical to C56I_ECOLI: Cytochrome b561 homolog 2 (yceJ) from Escherichia coli (strain K12)

KEGG orthology group: K12262, cytochrome b561 (inferred from 100% identity to son:SO_3371)

Predicted SEED Role

"Cytochrome B561"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBX4 at UniProt or InterPro

Protein Sequence (183 amino acids)

>SO3371 hypothetical Cytochrome B561 (NCBI ptt file) (Shewanella oneidensis MR-1)
MFRNTKFNYGLIAIASHWLSAVVVIGLFAVGVWMVELTYYSPWYKTAPHWHKSIGLLLLA
LTLFRLVWRLVNPKPASEPNHQPWEKLAAHVAHIAIYFLLLLIMAAGILISTEEGRGIML
FDWFELPSFRPLFENQADIAGDIHQYAAYSLIALVVIHAVGALKHHFIDKDSTLLKMIKF
KRG