Protein Info for SO3368 in Shewanella oneidensis MR-1

Name: mutY
Annotation: A/G-specific adenine glycosylase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 TIGR01084: A/G-specific adenine glycosylase" amino acids 7 to 272 (266 residues), 403.3 bits, see alignment E=3e-125 PF00730: HhH-GPD" amino acids 36 to 170 (135 residues), 86.5 bits, see alignment E=2.3e-28 PF00633: HHH" amino acids 100 to 128 (29 residues), 29.9 bits, see alignment (E = 5.1e-11) PF14815: NUDIX_4" amino acids 235 to 350 (116 residues), 83.7 bits, see alignment E=1.2e-27

Best Hits

KEGG orthology group: K03575, A/G-specific adenine glycosylase [EC: 3.2.2.-] (inferred from 100% identity to son:SO_3368)

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBX7 at UniProt or InterPro

Protein Sequence (365 amino acids)

>SO3368 A/G-specific adenine glycosylase (NCBI ptt file) (Shewanella oneidensis MR-1)
MKSTASFATRIVNWYDNHGRKTLPWQQDKTPYRVWVSEIMLQQTQVATVIPYYQRFMQRF
PNVLALANAPDDEVLHHWTGLGYYARARNLHKAAKMIRDEYQGQFPTDFEQVLALPGIGR
STAGAVLSLSLGQHHPILDGNVKRVLARHGAIEGWPGQKPVEERLWQLTEQLTPQQDIQK
YNQAMMDIGASICTRSKPNCAACPVAVDCKAQLMGRQTDFPGKKPKKTIPEKSAWMLVLF
KDNQVFLAKRPPAGIWGGLWCFPEFSSEAALNTELEAQGYQPTQLEPLIGFRHTFSHFHL
DIQPMLLDLDKWASGKPSVGAIMEQNQSLWYNINQPSKVGLAAATERVLANLGSLVAIAR
NHCSQ