Protein Info for SO3359 in Shewanella oneidensis MR-1

Annotation: oxygen-independent coproporphyrinogen III oxidase, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 TIGR00539: putative oxygen-independent coproporphyrinogen III oxidase" amino acids 14 to 376 (363 residues), 445.6 bits, see alignment E=7e-138 PF04055: Radical_SAM" amino acids 17 to 185 (169 residues), 83.4 bits, see alignment E=2.2e-27 PF06969: HemN_C" amino acids 312 to 376 (65 residues), 47.4 bits, see alignment E=1.6e-16

Best Hits

Swiss-Prot: 57% identical to HEMW_HAEIN: Heme chaperone HemW (hemW) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02495, oxygen-independent coproporphyrinogen III oxidase [EC: 1.3.99.22] (inferred from 100% identity to son:SO_3359)

Predicted SEED Role

"Radical SAM family enzyme, similar to coproporphyrinogen III oxidase, oxygen-independent, clustered with nucleoside-triphosphatase RdgB" in subsystem Heat shock dnaK gene cluster extended or Heme and Siroheme Biosynthesis or Queuosine-Archaeosine Biosynthesis

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.22

Use Curated BLAST to search for 1.3.99.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBY6 at UniProt or InterPro

Protein Sequence (385 amino acids)

>SO3359 oxygen-independent coproporphyrinogen III oxidase, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MSVNVSPQLTLPPLSLYIHIPWCVQKCPYCDFNSHGQNGELPQQAYVDALLADLRQDLHL
VQGRKLHTIFIGGGTPSLFDANQIKRILDDANALIPFSDGIEITMEANPGTLEHDDFSAY
RAAGVTRLSIGVQSFSKDKLNLLGRIHDQNEAQTAAQKARQADYLSFNLDLMHGLPNQSF
EEAMADIDTAASLNPPHLSWYQLTIEPNTLFHSKPPQLPDDEDLWQIYEQGQQKLAALGY
EQYEISAYAKPGYQCQHNLNYWQFGDYLGIGCGAHGKVTLPEENRIIRTVKIKHPKGYLT
ADNYTFEQTEVAQEDRALEYLMNRLRLMTPIPKQEFEDRTGLPRDVLKDGMEKAKQRGLL
TESAEHWQLTNKGHMFVNDLLTQFC