Protein Info for SO3342 in Shewanella oneidensis MR-1

Updated annotation (from data): putative transporter, required for L-alanine utilization
Rationale: PFam PF03458.9 (UPF0126). conserved specific phenotype of UPF0126
Original annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 33 to 53 (21 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 92 to 109 (18 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 152 to 169 (18 residues), see Phobius details amino acids 175 to 193 (19 residues), see Phobius details PF03458: Gly_transporter" amino acids 10 to 82 (73 residues), 82.2 bits, see alignment E=1e-27 amino acids 95 to 167 (73 residues), 81.2 bits, see alignment E=2.1e-27

Best Hits

Swiss-Prot: 56% identical to YICG_ECOLI: UPF0126 inner membrane protein YicG (yicG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to son:SO_3342)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EC03 at UniProt or InterPro

Protein Sequence (213 amino acids)

>SO3342 putative transporter, required for L-alanine utilization (Shewanella oneidensis MR-1)
MQEAQFIGLLWLIGILAEAMTGALAAGRKQMDLFGVVIIGCATAIGGGTLRDMLLGNYPL
VWVENVHYLIAIAFASLLTVAIAPVMRYLSKLFLAIDALGLAVFSIVGAQKTLMLGFSPT
IAVVMGLVTGVFGGVIRDILCNQVPLIFKKELYAVISLFTAGLYITLNAYQLEEWINLVI
CLTLGFSLRMLALRYHWSMPTFDYQSSGDQHTH