Protein Info for SO3311 in Shewanella oneidensis MR-1

Name: hisS
Annotation: histidyl-tRNA synthetase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 TIGR00442: histidine--tRNA ligase" amino acids 6 to 410 (405 residues), 524.7 bits, see alignment E=8.4e-162 PF13393: tRNA-synt_His" amino acids 10 to 312 (303 residues), 155.8 bits, see alignment E=3.2e-49 PF00587: tRNA-synt_2b" amino acids 68 to 316 (249 residues), 96 bits, see alignment E=6e-31 PF03129: HGTP_anticodon" amino acids 330 to 422 (93 residues), 51.3 bits, see alignment E=2.2e-17

Best Hits

Swiss-Prot: 100% identical to SYH_SHEON: Histidine--tRNA ligase (hisS) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01892, histidyl-tRNA synthetase [EC: 6.1.1.21] (inferred from 100% identity to son:SO_3311)

Predicted SEED Role

"Histidyl-tRNA synthetase (EC 6.1.1.21)" (EC 6.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EC33 at UniProt or InterPro

Protein Sequence (425 amino acids)

>SO3311 histidyl-tRNA synthetase (NCBI ptt file) (Shewanella oneidensis MR-1)
MAKQIQAIRGMNDILPTQSPLWQKVEAVLRSSVAAYGYSEIRTPIVENTDLFKRSIGEVT
DIVEKEMYTFEDRNGDSLTLRPEGTASTVRAGNEHGLLYNQEQRLWYMGPMFRHERPQKG
RYRQFHQFGVEIYGIGSADIDAEVLMLSARLWEKLGITEHVTLELNTLGDPAERAAYREA
LIAFLEQHKDKLDEDSQRRMYSNPLRVLDSKDPQVQSILADAPALMDYLGEESSQHFAQL
RELLDAVGIQYRVNSRLVRGLDYYNRTVFEWVTNSLGSQGTVLAGGRYDGLVAQLGGKET
PAVGFAMGLERIVLLLETLALTQDIPAEVDVYVAAMGDNCLVEAIKVAQELRSALPTLRV
MSHCGGGNLKKQMKRADKSGAQVALLIGEEELAEGVVTVKYLRNDNEQQRVARNALSAFL
AELTK