Protein Info for SO3294 in Shewanella oneidensis MR-1

Name: xseA
Annotation: exodeoxyribonuclease VII, large subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 PF13742: tRNA_anti_2" amino acids 9 to 101 (93 residues), 109.5 bits, see alignment E=1.2e-35 TIGR00237: exodeoxyribonuclease VII, large subunit" amino acids 10 to 356 (347 residues), 427 bits, see alignment E=4e-132 PF01336: tRNA_anti-codon" amino acids 29 to 101 (73 residues), 43.1 bits, see alignment E=5e-15 PF02601: Exonuc_VII_L" amino acids 125 to 437 (313 residues), 357.2 bits, see alignment E=1.5e-110

Best Hits

Swiss-Prot: 100% identical to EX7L_SHEON: Exodeoxyribonuclease 7 large subunit (xseA) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03601, exodeoxyribonuclease VII large subunit [EC: 3.1.11.6] (inferred from 100% identity to son:SO_3294)

MetaCyc: 48% identical to exodeoxyribonuclease VII subunit XseA (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease VII. [EC: 3.1.11.6]

Predicted SEED Role

"Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EC50 at UniProt or InterPro

Protein Sequence (445 amino acids)

>SO3294 exodeoxyribonuclease VII, large subunit (NCBI ptt file) (Shewanella oneidensis MR-1)
MQVPKNNIYTVSRLNGEVRQILEGQLGKIWLNGEISNFSTPSSGHWYLTLKDHFSQIRCA
MFKGRNQSVSFKPVNGQQVIVKGAISVYEPRGDYQLLIESMLPAGDGLLAQQFEALKMKL
AALGLFAADTKRALPKNIQRIGVITSPTGAAIRDVLHVLARRDPSIEVIIYPTQVQGENA
DINICQAINIANQRLEVDVLLLTRGGGSLEDLWCFNSEALAHTIYNSALPIVSAVGHEVD
TTISDYVADVRAPTPSAGAELLSQDSDNKSQRLATVLARLKQSASHYQLKQERRLSLLEH
RLQRLDPKRTLQQFEQRFDEMQLRLEAALTNKLHGLSRRQQQLASRLEQQSPKHKLALEA
NRLSYLATRLQDAMQDKLSHSGQRIKYVAHQLETVSPLATLSRGYSITTDVNGAVITSAS
QISLGDTITTQLSNERLMSTVTRLP