Protein Info for SO3288 in Shewanella oneidensis MR-1

Annotation: transglycosylase, Slt family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 PF00497: SBP_bac_3" amino acids 14 to 235 (222 residues), 75.1 bits, see alignment E=4.4e-25 PF01464: SLT" amino acids 268 to 367 (100 residues), 69.3 bits, see alignment E=2.2e-23

Best Hits

Swiss-Prot: 100% identical to MLTF_SHEON: Membrane-bound lytic murein transglycosylase F (mltF) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: None (inferred from 100% identity to son:SO_3288)

Predicted SEED Role

"Transglycosylase, Slt family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EC56 at UniProt or InterPro

Protein Sequence (457 amino acids)

>SO3288 transglycosylase, Slt family (NCBI ptt file) (Shewanella oneidensis MR-1)
MEETEFVPHKLTELRVGTLYGPQIYMTSGQGNSGFDYDMAVLFAEYLDVPLKMVPYTNLA
ELYDALKKNEIDIIAAGMTETPARREHFRLGPPLYRVNQVLVYREGMPAPKDISDLKGKI
TVIADSSFVETLTQLQKRHPTLVWDQVTDKDNEELLTMIANKEIDYTIADSSSVQINRRY
LPVLRSGLVLEEKLNVVWLLPPTHSDGLMSQLLAFWHQEKLAGTLDHLNEKYFGHVKRFD
YIDTRAFLRAIETVLPRYRQHFETHAGDLDWRKLAATSYQESHWNPNARSPTGVRGMMML
TQPTAKEIGITNRLDAEESIRGGAAYLRDMINRLPESIPESQRMWFALASYNIGYAHVED
ARKLAESMELNPNAWQDLKKVLPLLQKRKYYQKTRYGYARGSEAVHYVDSIRRYYDTLVW
VDNQSKQQNSEEVAPSDLTAEETPVPAPGTLSPDKPK