Protein Info for SO3282 in Shewanella oneidensis MR-1

Annotation: methyl-accepting chemotaxis protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 667 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 309 to 335 (27 residues), see Phobius details PF17201: Cache_3-Cache_2" amino acids 42 to 306 (265 residues), 215.2 bits, see alignment E=3.3e-67 PF17202: sCache_3_3" amino acids 107 to 216 (110 residues), 113.1 bits, see alignment E=2e-36 PF17203: sCache_3_2" amino acids 111 to 217 (107 residues), 32.8 bits, see alignment E=1.8e-11 PF00672: HAMP" amino acids 335 to 387 (53 residues), 24.5 bits, see alignment 6.7e-09 PF00015: MCPsignal" amino acids 477 to 633 (157 residues), 143.5 bits, see alignment E=1.5e-45

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_3282)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EC62 at UniProt or InterPro

Protein Sequence (667 amino acids)

>SO3282 methyl-accepting chemotaxis protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MNYKNWPIAKQIGTLAFVLTLIVFCILGTLSYKSASNVLEDKGISAMKAEMHAVSDMLEL
QYDSLLQLARRNADVFKGMYPGQFSLLDKKVDILGVNTPALMHETEQLNASKSKVDRFAN
LTGGTATVFALAGDDFVRIATSVKKADGSRALGTFLGKNHPGYPTLMKGEIYEGYAKLFG
KDYMTVYRPIKDMQGQVIGILFIGFEITQSLKQLQEAVNKITLEESGHFLLMRKADNVLV
AHPKFNTGEPVTESMLDGLTLSQATQNQAEWRYANSKNQPMFAYSQNVNGWNWMLIGQVN
ANELNEEGLLLLTINAIVAVSGIVLITVLLSLVLLRSLKPLHALQQHMEIIGSGDFSHHL
PPSAFDSQNEVDKITTSVSTMSSELRQLISALQTSVQSIEQQASKAQRIAKQNGEEAQAL
MQQTDQIATAIEEMSTSIRDVANHAQEGANQNQQVDIAAKEGQQQQTRLVQDLLKLSQQL
NNSHQAVDKVSQESEAISKVTEVINSIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVR
TLAKRTQTSILEIGQTIDKLQTQVKTTTSQMAQSHQLGIASANQGEETGHQLEEINRRIA
ELAISSRNIASATEQQSSVAQEITHNLHQISELANEGEHRAAETVNSANELSSLAIALKQ
QISQFKA