Protein Info for SO3249 in Shewanella oneidensis MR-1

Name: flgC
Annotation: flagellar basal-body rod protein FlgC (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 TIGR01395: flagellar basal-body rod protein FlgC" amino acids 4 to 138 (135 residues), 169.9 bits, see alignment E=1.8e-54 PF00460: Flg_bb_rod" amino acids 8 to 32 (25 residues), 36.5 bits, see alignment 3.8e-13 PF06429: Flg_bbr_C" amino acids 93 to 135 (43 residues), 55.3 bits, see alignment E=3.7e-19

Best Hits

KEGG orthology group: K02388, flagellar basal-body rod protein FlgC (inferred from 100% identity to son:SO_3249)

Predicted SEED Role

"Flagellar basal-body rod protein FlgC" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EC95 at UniProt or InterPro

Protein Sequence (138 amino acids)

>SO3249 flagellar basal-body rod protein FlgC (NCBI ptt file) (Shewanella oneidensis MR-1)
MGLFNIFDVAGSGMSAQSLRLNTTASNIANADSVSSSIDKTYRSRHPIFEAEMAKAQSQQ
QASQGVAVKGIVESDKPLLKEYSPDHPMADGDGFIYKPNVNVMEEMADMISASRSYQMNV
QVAEAAKSMLQQTLGMGK