Protein Info for SO3244 in Shewanella oneidensis MR-1

Name: flgG
Annotation: flagellar basal-body rod protein FlgG (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 TIGR02488: flagellar basal-body rod protein FlgG" amino acids 4 to 261 (258 residues), 373.8 bits, see alignment E=4.7e-116 TIGR03506: flagellar hook-basal body protein" amino acids 4 to 137 (134 residues), 147.4 bits, see alignment E=8.6e-47 amino acids 147 to 244 (98 residues), 101.4 bits, see alignment E=8.5e-33 PF00460: Flg_bb_rod" amino acids 10 to 35 (26 residues), 35.6 bits, see alignment (E = 1e-12) PF22692: LlgE_F_G_D1" amino acids 96 to 160 (65 residues), 92.1 bits, see alignment E=2.9e-30 PF06429: Flg_bbr_C" amino acids 216 to 260 (45 residues), 71 bits, see alignment 7.1e-24

Best Hits

Swiss-Prot: 55% identical to FLGG_ECOLI: Flagellar basal-body rod protein FlgG (flgG) from Escherichia coli (strain K12)

KEGG orthology group: K02392, flagellar basal-body rod protein FlgG (inferred from 100% identity to son:SO_3244)

Predicted SEED Role

"Flagellar basal-body rod protein FlgG" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ECA0 at UniProt or InterPro

Protein Sequence (262 amino acids)

>SO3244 flagellar basal-body rod protein FlgG (NCBI ptt file) (Shewanella oneidensis MR-1)
MHPALWISKTGLDAQQTDISVISNNVANASTVGYKKSRAVFEDLLYQTVNQAGGISASNT
KLPNGLNIGAGTKVVATQKMFTQGNMLTTDNSLDLMIEGPGFFEIQLPDGTTAYTRNGQF
TLDDTGQIVTPGSGYVLQPPITIPEDATSITVSAEGEVSVKTPGAAENQVVGQLSMTDFI
NPSGLDPMGQNLYTETGASGTPIQGTASLDGMGAIRQGALETSNVNVTEELVNLIESQRI
YEMNSKVISAVDQMLAYVNQNL