Protein Info for SO3232 in Shewanella oneidensis MR-1

Name: flrA
Annotation: flagellar regulatory protein A (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 PF06490: FleQ" amino acids 7 to 112 (106 residues), 109.5 bits, see alignment E=3.3e-35 PF00158: Sigma54_activat" amino acids 134 to 301 (168 residues), 250.2 bits, see alignment E=2.6e-78 PF14532: Sigma54_activ_2" amino acids 135 to 305 (171 residues), 60.8 bits, see alignment E=5.7e-20 PF07728: AAA_5" amino acids 158 to 287 (130 residues), 30.6 bits, see alignment E=9.5e-11 PF25601: AAA_lid_14" amino acids 307 to 380 (74 residues), 69.3 bits, see alignment E=6.4e-23 PF02954: HTH_8" amino acids 432 to 472 (41 residues), 47.7 bits, see alignment 3.2e-16

Best Hits

KEGG orthology group: K10941, sigma-54 specific transcriptional regulator, flagellar regulatory protein A (inferred from 100% identity to son:SO_3232)

Predicted SEED Role

"Flagellar regulatory protein FleQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ECB1 at UniProt or InterPro

Protein Sequence (477 amino acids)

>SO3232 flagellar regulatory protein A (NCBI ptt file) (Shewanella oneidensis MR-1)
MMQTDQRILLVGTPSERLSRLCCIFEFLGEQIDIITIEKLSTCLQETRFRALVISIDNMS
ADALKLVASQYPWQPILLFGHVGELQVSNVLGHIEEPLNYPQLTELLHFCQVYGQVKRPQ
VPTSANQTKLFRSLVGRSDGIANVRHLISQVATSDATVLVLGQSGTGKEVVARNIHYLSE
RRDGPFIPVNCGAIPPELLESELFGHEKGSFTGAISSRKGRFELAEGGTLFLDEIGDMPL
QMQVKLLRVLQERVFERVGGTKTINADVRVVAATHRDLETMISSNEFREDLYYRLNVFPI
EMPALSERKDDVPLLLQELVSRVYNEGRGKVRFTQRAIESLKEHAWSGNVRELSNLVERL
TILYPGGLVDVNDLPIKYRHIDVPEYSVELSEEQQERDALASIFTSEEPVEIPETRFPSE
LPPEGVNLKDLLAELEIDMIRQALEQQDNVVARAAEMLGIRRTTLVEKMRKYGMTKE