Protein Info for SO3230 in Shewanella oneidensis MR-1

Name: flrC
Annotation: flagellar regulatory protein C (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 PF00072: Response_reg" amino acids 7 to 115 (109 residues), 93.8 bits, see alignment E=2.7e-30 PF00158: Sigma54_activat" amino acids 132 to 294 (163 residues), 227.2 bits, see alignment E=3.6e-71 PF14532: Sigma54_activ_2" amino acids 144 to 299 (156 residues), 69.1 bits, see alignment E=1.7e-22 PF07724: AAA_2" amino acids 150 to 274 (125 residues), 29.1 bits, see alignment E=3.5e-10 PF07728: AAA_5" amino acids 152 to 270 (119 residues), 32.4 bits, see alignment E=3.1e-11 PF02954: HTH_8" amino acids 398 to 436 (39 residues), 37.8 bits, see alignment 4.5e-13

Best Hits

KEGG orthology group: K10943, two component system, response regulator FlrC (inferred from 100% identity to son:SO_3230)

Predicted SEED Role

"Flagellar regulatory protein FleQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ECB3 at UniProt or InterPro

Protein Sequence (446 amino acids)

>SO3230 flagellar regulatory protein C (NCBI ptt file) (Shewanella oneidensis MR-1)
MSEAKLLLVEDDASLREALLDTLMLAQYDCIDVASGEEAILALKQHQFDLVISDVQMPGI
GGLGLLNYLQQHHPKLPVLLMTAYATIGSAVSAIKLGAVDYLAKPFAPEVLLNQVSRYLP
LKQNRDQPVVADEKSLSLLSLAQRVAASDASVMILGPSGSGKEVLARYIHQHSSRAEEAF
VAINCAAIPENMLEATLFGYEKGAFTGAYQACPGKFEQAQGGTLLLDEISEMDLGLQAKL
LRVLQEREVERLGGRKTIKLDVRVLATSNRDLKAVVAAGQFREDLYYRINVFPLTWPALN
QRPADILPLARHLLTKHAKALNVVDLPEFDDAACRRLLSHRWPGNVRELDNVVQRALILR
AGALITANDIIIDAQDVPLTSDDAEYMSEPEGLGEELKAQEHVIILETLVQCQGSRKLVA
EKLGISARTLRYKMARMRDMGIQLPS