Protein Info for SO3215 in Shewanella oneidensis MR-1

Name: flhB
Annotation: flagellar biosynthetic protein FlhB (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 189 to 213 (25 residues), see Phobius details PF01312: Bac_export_2" amino acids 8 to 347 (340 residues), 430.7 bits, see alignment E=2.1e-133 TIGR00328: flagellar biosynthetic protein FlhB" amino acids 8 to 353 (346 residues), 415.6 bits, see alignment E=8.7e-129

Best Hits

KEGG orthology group: K02401, flagellar biosynthetic protein FlhB (inferred from 100% identity to son:SO_3215)

Predicted SEED Role

"Flagellar biosynthesis protein FlhB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ECC8 at UniProt or InterPro

Protein Sequence (376 amino acids)

>SO3215 flagellar biosynthetic protein FlhB (NCBI ptt file) (Shewanella oneidensis MR-1)
MAEESSGERSEEPTGRRLDQAREKGQVARSKELGTATVLLSAATGLYMLGPGIAKALSNV
FERVFTMDRAAIFDTNQMFNVWGVVGSEIGWPLLKIMLLIVVVAFIGNVSLGGMNFSTQA
MMPKASKMSPIAGFKRMFGVQALVELTKGIAKFSVVALASYLLLSHYFNDILLLSADHLP
GNVYHALDLLVWMFILLCSSVLVIVVIDVPFQIWNHNKQLKMTKQEVKDEYKDTEGKPEV
KGRVRQMQRELAQRRMMAEVPNADVIVVNPEHYAVAIKYDVKRSAAPFVIAKGVDEVAFK
IREVARAHNIAIVTAPPLARAIYHTTKLDQQVPEGLFTAVAQVLAYVFQLRQYQKGRGRK
PIPIPLNQPIPDDLKY