Protein Info for SO3209 in Shewanella oneidensis MR-1

Name: cheY-3
Annotation: chemotaxis protein CheY (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 PF00072: Response_reg" amino acids 7 to 119 (113 residues), 112 bits, see alignment E=8.6e-37

Best Hits

Swiss-Prot: 84% identical to CHEY_PSEAE: Chemotaxis protein CheY (cheY) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03413, two-component system, chemotaxis family, response regulator CheY (inferred from 98% identity to swp:swp_1539)

Predicted SEED Role

"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ECD4 at UniProt or InterPro

Protein Sequence (127 amino acids)

>SO3209 chemotaxis protein CheY (NCBI ptt file) (Shewanella oneidensis MR-1)
MDKNMKILIVDDFSTMRRIIKNLLRDLGFNNTQEADDGSTALPMLQKGDFDFVVTDWNMP
GMQGIDLLKAIRADDSLKHLPVLMVTAEAKREQIIAAAQAGVNGYVVKPFTAATLKEKLD
KIFERLA