Protein Info for SO3208 in Shewanella oneidensis MR-1

Name: cheZ
Annotation: chemotaxis protein CheZ (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF04344: CheZ" amino acids 43 to 245 (203 residues), 257 bits, see alignment E=7.2e-81

Best Hits

Swiss-Prot: 72% identical to CHEZ_SHELP: Protein phosphatase CheZ (cheZ) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K03414, chemotaxis protein CheZ (inferred from 100% identity to son:SO_3208)

Predicted SEED Role

"Chemotaxis response - phosphatase CheZ" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ECD5 at UniProt or InterPro

Protein Sequence (245 amino acids)

>SO3208 chemotaxis protein CheZ (NCBI ptt file) (Shewanella oneidensis MR-1)
MKSQTSGLITLEHAQRLVELLSANEHSQADDLFRELAAPLQRELFDEVGKLTRQLHSALM
DFQIDNRLVELANTEIPDAKERLSYVIDMTEQAANKTMDAVEECLPLANALTANIQQVMP
SWEKLMRREIALTDFKVLCHNVQHLMSRSELDSNRLRELLNQILMAQDFQDLTGQMIRRV
IDLVMEVESNLVSMLTVFGEQPMIESQITQKNNIEAEGPIMNAELRQDVVTGQDEVDDLL
SSLGF