Protein Info for SO3189 in Shewanella oneidensis MR-1

Annotation: polysaccharide biosynthesis protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01370: Epimerase
  • amino acids 18 to 263 (246 residues), 200.4 bits, E=7.8e-63
• PF16363: GDP_Man_Dehyd
  • amino acids 19 to 330 (312 residues), 177.5 bits, E=1.3e-55
• PF01073: 3Beta_HSD
  • amino acids 19 to 257 (239 residues), 76.3 bits, E=5.2e-25
• PF02719: Polysacc_synt_2
  • amino acids 19 to 278 (260 residues), 71.3 bits, E=2e-23
• PF07993: NAD_binding_4
  • amino acids 20 to 188 (169 residues), 33.8 bits, E=5.2e-12

Best Hits

Swiss-Prot: 80% identical to GNE_PLESH: UDP-N-acetylglucosamine 4-epimerase (wbgU) from Plesiomonas shigelloides

KEGG orthology group: K02473, UDP-N-acetylglucosamine 4-epimerase [EC: 5.1.3.7] (inferred from 100% identity to son:SO_3189)

MetaCyc: 80% identical to UDP-N-acetylglucosamine C4-epimerase subunit (Plesiomonas shigelloides)
UDP-N-acetylglucosamine 4-epimerase. [EC: 5.1.3.7]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• D-galactose degradation I (Leloir pathway) (4/5 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• D-galactose detoxification (2/3 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• colanic acid building blocks biosynthesis (6/11 steps found)
• stachyose degradation (3/7 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2 or 5.1.3.7

Sequence Analysis Tools

See Q8ECF3 at UniProt or InterPro

Protein Sequence (340 amino acids)

>SO3189 polysaccharide biosynthesis protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MTRYEQIKQELLNSPKTWLITGVAGFIGSNLLEQLLKLNQTVIGLDNFATGRQHNLDEVQ
SLVTSEQWMRFSFINGDIRDYAICEAVVNGVDYVLHQAALGSVPRSIADPITTNAANITG
FLNMLQAAKEAEVKSFTYAASSSTYGDHPALPKVEQNIGNPLSPYAVTKYVNELYASVYA
RTYGFETIGLRYFNVFGRRQDPNGAYAAVIPKWTSSMIKGEDVFINGDGETSRDFCYIDN
VVQMNILAATAASEAKNEVYNVAVGDRTTLNDLYFAIKDSLNANGINVNQNPNYRDFRAG
DVRHSQADVSKAVTRLGYQYTHKILEGISEAMPWYKEFLA