Protein Info for SO3186 in Shewanella oneidensis MR-1

Name: rfbA
Annotation: glucose-1-phosphate-thymidylyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 48 to 67 (20 residues), see Phobius details PF00483: NTP_transferase" amino acids 16 to 252 (237 residues), 260 bits, see alignment E=2.4e-81 TIGR01207: glucose-1-phosphate thymidylyltransferase" amino acids 16 to 300 (285 residues), 516.6 bits, see alignment E=7.4e-160 PF12804: NTP_transf_3" amino acids 17 to 137 (121 residues), 31.5 bits, see alignment E=1.9e-11

Best Hits

Swiss-Prot: 74% identical to RMLA2_ECOLI: Glucose-1-phosphate thymidylyltransferase 2 (rffH) from Escherichia coli (strain K12)

KEGG orthology group: K00973, glucose-1-phosphate thymidylyltransferase [EC: 2.7.7.24] (inferred from 100% identity to son:SO_3186)

MetaCyc: 74% identical to glucose-1-phosphate thymidylyltransferase 2 (Escherichia coli K-12 substr. MG1655)
Glucose-1-phosphate thymidylyltransferase. [EC: 2.7.7.24]

Predicted SEED Role

"Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 2.7.7.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.24

Use Curated BLAST to search for 2.7.7.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ECF6 at UniProt or InterPro

Protein Sequence (304 amino acids)

>SO3186 glucose-1-phosphate-thymidylyltransferase (NCBI ptt file) (Shewanella oneidensis MR-1)
MELNTQHSTLKTHNTKGIILAGGSGTRLYPITKGVSKQLLPVYDKPMIYYPISVLMLAGI
RDILIITTPEDQSSFQRLLGDGSDFGISLQYAVQVTPDGLAQAFIIGEEFIGNDNVCLAL
GDNIFWGQGFSPILKKAAARPTGASVFGYQVKDPERFGVVEFDQDLKAISIEEKPLKPKS
NFAVTGLYFYDNRVVNIAKNVKPSERGELEITSINQAYLEMGKLNVELLGRGFAWLDTGT
YESLLEAASFVETIEKRQGYKIACLEEIAWRNHWLSNEQILKVANEMSKNSYGQYLLGLV
EIKK