Protein Info for SO3173 in Shewanella oneidensis MR-1

Annotation: UDP-galactose 4-epimerase, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 5 to 190 (186 residues), 69.9 bits, see alignment E=6.9e-23 PF01370: Epimerase" amino acids 6 to 223 (218 residues), 106.3 bits, see alignment E=6.2e-34 PF01073: 3Beta_HSD" amino acids 8 to 241 (234 residues), 61.4 bits, see alignment E=2.5e-20 PF13460: NAD_binding_10" amino acids 10 to 168 (159 residues), 51.3 bits, see alignment E=4.7e-17 PF16363: GDP_Man_Dehyd" amino acids 35 to 304 (270 residues), 50.6 bits, see alignment E=7.3e-17 PF02719: Polysacc_synt_2" amino acids 43 to 248 (206 residues), 29.9 bits, see alignment E=1.2e-10 PF07993: NAD_binding_4" amino acids 50 to 170 (121 residues), 39.3 bits, see alignment E=1.5e-13

Best Hits

Swiss-Prot: 54% identical to GALE_VIBCL: UDP-glucose 4-epimerase (galE) from Vibrio cholerae

KEGG orthology group: None (inferred from 100% identity to son:SO_3173)

MetaCyc: 54% identical to UDP-N-acetyl-alpha-D-quinovosamine dehydrogenase (Pseudomonas aeruginosa)
RXN-14767 [EC: 1.1.1.426]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 1.1.1.426 or 5.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ECG9 at UniProt or InterPro

Protein Sequence (309 amino acids)

>SO3173 UDP-galactose 4-epimerase, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MPTQSILLTGATGFVGQQILRQLPQDTRVFGRTKPARDCHFFAGELTANTDYRSALSGVD
VVIHCAARAHVMNETANNAAQLYQEVNTLVTLALAEQAAAAGVKRFIFISTIKVNGEATI
AGQLFRASDARQPLDHYGESKAKAEIGLFDIARKTEIEVVIIRPPLVYGPNVKANFATML
NLAKKNLPLPFGAIHNKRSMVALDNLVDLIVTCIEHPNAANQIFLVSDDQDVSTTELLKL
MTGAAGKKPRLLPVPMAWLILAGKVTGNQAIIDRLCGNLQVDITHTKNTLSWQPPITVEE
GVRRCFVKE