Protein Info for SO3144 in Shewanella oneidensis MR-1

Name: etfA
Annotation: electron transfer flavoprotein, alpha subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 PF01012: ETF" amino acids 3 to 167 (165 residues), 125.5 bits, see alignment E=2.2e-40 PF00766: ETF_alpha" amino acids 189 to 268 (80 residues), 123.5 bits, see alignment E=2.8e-40

Best Hits

Swiss-Prot: 69% identical to ETFA_PSEAE: Electron transfer flavoprotein subunit alpha (etfA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03522, electron transfer flavoprotein alpha subunit (inferred from 100% identity to son:SO_3144)

Predicted SEED Role

"Electron transfer flavoprotein, alpha subunit" in subsystem Acetyl-CoA fermentation to Butyrate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ECJ8 at UniProt or InterPro

Protein Sequence (308 amino acids)

>SO3144 electron transfer flavoprotein, alpha subunit (NCBI ptt file) (Shewanella oneidensis MR-1)
MAILVLAEHDNAALKLDTAKVVTAARAIGDDIHVLVVGHQCGAVVQAAQALQGVAQVLVA
DNSVYEAHLAENVAKLLVDLAPSYSHILAAASSAGKDTLPRAAALLDVAQISEVIAVVSS
DTFVRPIYAGNALATVQSHDAVKVMTVRASAFDAAAQGNSAAVTTLDKVFAAKTQFVSQS
LTVSARPELGNAGIIVSGGRGMGSGENFGMLEQLADKLGAAVGASRAAVDAGFVPNDLQV
GQTGKIVAPNLYIAVGISGAIQHLAGMKDAKVIVAINKDPEAPIFQVADYGLEADLFEAV
PELIACLS