Protein Info for SO3136 in Shewanella oneidensis MR-1

Name: dctM
Annotation: C4-dicarboxylate transport protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 signal peptide" amino acids 5 to 11 (7 residues), see Phobius details transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 114 to 132 (19 residues), see Phobius details amino acids 139 to 163 (25 residues), see Phobius details amino acids 169 to 194 (26 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 309 to 327 (19 residues), see Phobius details amino acids 339 to 361 (23 residues), see Phobius details amino acids 369 to 387 (19 residues), see Phobius details amino acids 393 to 415 (23 residues), see Phobius details amino acids 427 to 449 (23 residues), see Phobius details PF06808: DctM" amino acids 7 to 451 (445 residues), 366.8 bits, see alignment E=7e-114 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 260 (244 residues), 270.1 bits, see alignment E=1.5e-84

Best Hits

KEGG orthology group: K11690, C4-dicarboxylate transporter, DctM subunit (inferred from 100% identity to son:SO_3136)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ECK2 at UniProt or InterPro

Protein Sequence (465 amino acids)

>SO3136 C4-dicarboxylate transport protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MAIATLFCVLFICMFLGMPIAIALGFSSMLTILFFSNDSLASVALKLYESSSEHYTLLAI
PFFILSSAFLSTGGVARRIIDFAMDCVGHIRGGLAMASVMACMLFAAVSGSSPATVAAIG
SIVIVGMVKAGYPEKFASGVITTSGTLGILIPPSIVMLVYAAATEVSVAKIFMAGLVPGL
LLGFLIMVVIYIVARIKNLPSIPFPGFKKLGVSSAKAIGGLALIFIVLGSIYGGVASPTE
ASAVACVYAYFIAVFGYRDIGPLKNVAWRNPNEAIPSAIARNLGHMVLGLIKTPIDKEIR
HVVRDGAKVSIMLLFIIANAMLFAHVLTTERIPHIIAEYIVGMGLPAWGFLIIVNLLLLA
AGNFMEPSAIVLIMAPILFPIATQLGIDPIHLGIIMVVNMEIGMLTPPVGLNLFVTSGIT
GRNIGWVIQSVLPWLVFMLAFLMLITYVPQISLFLPELLDKLNGY