Protein Info for SO3135 in Shewanella oneidensis MR-1

Annotation: C4-dicarboxylate transporter, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 41 to 63 (23 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details PF04290: DctQ" amino acids 21 to 178 (158 residues), 80.5 bits, see alignment E=5.5e-27

Best Hits

KEGG orthology group: K11689, C4-dicarboxylate transporter, DctQ subunit (inferred from 100% identity to son:SO_3135)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ECK3 at UniProt or InterPro

Protein Sequence (219 amino acids)

>SO3135 C4-dicarboxylate transporter, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MIARIFGYFEEGVLNLLITLMTLLVFTEVVARFFFDTGFLWIQELTLTLCGWFVLFGMSY
GVKVGAHIGVDALVKKLPPNAKKITSLITTLICLTYCILFLKGSWSYLSQMYQIGVPMED
IHFPAWLLARLDPDWAWNVLKIDIEDGAVPIWISQSILLIGFSMLTWRFIELFVAILRNQ
VTGLSFADEAKESMHLIDDTAIQSQGPQHTTGAAHKELP