Protein Info for SO3120 in Shewanella oneidensis MR-1

Annotation: oxidoreductase, Gfo/Idh/MocA family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF10518: TAT_signal" amino acids 3 to 23 (21 residues), 24.8 bits, see alignment (E = 2.3e-09) TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 6 to 27 (22 residues), 18.5 bits, see alignment (E = 9.9e-08) PF01408: GFO_IDH_MocA" amino acids 55 to 181 (127 residues), 66.1 bits, see alignment E=7.6e-22 PF21252: Glyco_hydro_109_C" amino acids 187 to 449 (263 residues), 358.2 bits, see alignment E=3.8e-111

Best Hits

Swiss-Prot: 100% identical to GH109_SHEON: Alpha-N-acetylgalactosaminidase (nagA) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: None (inferred from 100% identity to son:SO_3120)

Predicted SEED Role

"Predicted secreted alpha-N-acetylgalactosaminidase (EC 3.2.1.49)" in subsystem N-Acetyl-Galactosamine and Galactosamine Utilization (EC 3.2.1.49)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ECL7 at UniProt or InterPro

Protein Sequence (459 amino acids)

>SO3120 oxidoreductase, Gfo/Idh/MocA family (NCBI ptt file) (Shewanella oneidensis MR-1)
MHNIHRRHFLKAAGAVTAGLVTANIALNANASSVAPKPSSGKSVIGLIAPKMEVVRVGFI
GVGERGFSHVEQFCHLEGVELKAICDTHQAVVDRAVEHIVKQKRPKPAVYTGNDLSYREL
LNRDDIDIVIISTPWEWHAPMAIDTMESGKHAFVEVPLALTVEECWQIIDTAERTQKNCM
MMENVNYGREELMVLNMVRQGLFGELLHGEAAYIHELRWQMKEINHKTGSWRTYWHTKRN
GNLYPTHGLGPVSQYMNINRGDRFDYLTSMSSPALGRALYAKREFPADHERNQLKYINGD
MSTSLIKTVKGRTIMVQHDTTTPRPYSRHNLIQGTNGVFAGFPNRIAVENDGFGTSYHKW
DTDMQKWYDKYDHPLWQRIGKEAEINGGHGGMDFVMLWRMVYCLRNGEALDQDVYDGASW
SVVNILSEQSLNNRSNSVNFPDFTRGAWEHAKPLGIVGA