Protein Info for SO3106 in Shewanella oneidensis MR-1

Name: aprE
Annotation: cold-active serine alkaline protease (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 807 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF05922: Inhibitor_I9" amino acids 47 to 137 (91 residues), 34.8 bits, see alignment E=5.6e-12 PF00082: Peptidase_S8" amino acids 164 to 347 (184 residues), 103 bits, see alignment E=5e-33 amino acids 485 to 555 (71 residues), 59.2 bits, see alignment E=1.1e-19 PF02225: PA" amino acids 394 to 482 (89 residues), 27.8 bits, see alignment E=5.6e-10 PF04151: PPC" amino acids 604 to 670 (67 residues), 70.6 bits, see alignment E=3.9e-23 PF01483: P_proprotein" amino acids 727 to 806 (80 residues), 80.7 bits, see alignment E=1.7e-26

Best Hits

KEGG orthology group: K14645, serine protease [EC: 3.4.21.-] (inferred from 100% identity to son:SO_3106)

Predicted SEED Role

"Alkaline serine protease"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ECN0 at UniProt or InterPro

Protein Sequence (807 amino acids)

>SO3106 cold-active serine alkaline protease (NCBI ptt file) (Shewanella oneidensis MR-1)
MRIDKTTKIALSLSSLAIAISAGVNAAPEALGFAAAMQSQTSPLPKRYIVKFKNADAAVQ
ISAENVQASDQLPTTMNYQPQVAEISAQHSVLNKANAREMKRIGRSNSYSVKLDNTSLKA
LKARTDVEYVEEDAPRRFLTETTPWGQTYVGATQLSDSQAGNRTICIIDSGYDRAHPDLS
GNNVTGTNNSGTGNWFEPGNNNAHGTHVAGTIAAIANNDGVIGVMPNQNTNIHVIKVFNE
AGWGYSSSLVSAVDTCVNNGANVVTMSLGGAGSSTTERNALAAHYNNGVLLIAAAGNDGN
NTHSYPASYDSVMSVASVDSNKDHSAFSQYTNQVEISGPGEAILSTVTRGEGRLADITIG
GQSYFNSGVVPHNRFTPSGSNYAPNPYNGTATATLAECTVSGSTFNCGNMTNKVCLVERV
GNQGTAYPEINAVKACKTAGASAVIVYSNSALPGLQNPFLVDANSEINMVSVSVDRTTGL
ALRNQLGATVTVSNQGNKDYEYYNGTSMATPHVSGVATLVWSYHPQCSAAQIRNALKQTA
EDLGTAGRDDKTGYGLVNAMAAKAFLDASCNGPIDPVDPPPTDGVLVNGVPKTGLAGAAS
EELHFSFEVPQGATNLGFVMNGGTGDADLYVQYGAAPTTSNYDCRPYKGGNSESCPISNV
QSGTYYVMVKGYTAFSGVSLTASYTAGGTPPTAPSNYSNTDNYNIPDNKTAGISSPITVT
RTGNSGTVTAVVNIVHPYIGDLKVQLISPSGQISTLHNRTGAGTDNINKSYTVDMTGVES
SGVWKLKAVDSGRGDAGYIDSWELKFQ