Protein Info for SO3094 in Shewanella oneidensis MR-1

Annotation: TPR domain protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 679 signal peptide" amino acids 1 to 11 (11 residues), see Phobius details amino acids 25 to 27 (3 residues), see Phobius details transmembrane" amino acids 12 to 24 (13 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 306 to 319 (14 residues), see Phobius details amino acids 322 to 341 (20 residues), see Phobius details PF13519: VWA_2" amino acids 92 to 198 (107 residues), 60.9 bits, see alignment E=2.5e-20 PF07719: TPR_2" amino acids 405 to 437 (33 residues), 26.4 bits, see alignment (E = 7.1e-10)

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 83% identity to son:SO_3094)

Predicted SEED Role

"TPR domain protein in aerotolerance operon"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ECP1 at UniProt or InterPro

Protein Sequence (679 amino acids)

>SO3094 TPR domain protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSLHFIRPEWLLALLPLVIILWMLWRQHATNSAWNRYIAPHLAKVLVTEGSQKSRRPLHI
LAFSWFIATLALAGPALNKQSLPVFAAEQGRVLVMDMSVSMFATDLAPNRLTQAKFRATD
LLRSLKEGETGLIAFAGDAFTISPLTRDTGTLLNLLPTLSPEIMPVLGSNLAAALTQAKN
LLAQGGHLRGDIIVMTDGITPRQFDEANSVLTGSQYRLAIMGFGSNQGAPIRLPDGQLQR
DSSNEVAVAKTDFGLLQKLADNHNGIMIPNRADGEDLVQLQHWLSDSGDAKATDLDGETW
QDLGPYLALFLLIPALLSFRQGMLASWMLMGFASLLLGALPQNAHANAWNSLWHTQEQQA
MQAYQAEDYASAAQKFETPQWQGAAQYKAGNFEQALKSFEQDNSANGLYNQGNALMQMGK
PDKAKERYQAALDKQPDFPQAKANLELAEKLLEQQQSQQNANNQDKPSQGDQNQQGQDQN
DQQQGQNQQQGQQKEQQSSPNDPSQEQQAGEKQTQDNTSSAKDKQDNPEQEAQDQQQASD
DAAKQDANAGNQQQQSQQQEASEQNAQNNPTAESSEPASNESKMQAKVEDDKSKAKQEQQ
QAVAQHADKEKQSPTEKDPQAAVESLEPPPSNSDPLPADMQRALRGVSEDPQVLLRNKMQ
LEYQKRRQNGQISRDNEQW