Protein Info for SO3081 in Shewanella oneidensis MR-1

Annotation: Smr domain protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 PF01713: Smr" amino acids 93 to 167 (75 residues), 87.4 bits, see alignment E=2.8e-29

Best Hits

Swiss-Prot: 100% identical to Y3081_SHEON: UPF0115 protein SO_3081 (SO_3081) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: None (inferred from 99% identity to shm:Shewmr7_1479)

Predicted SEED Role

"FIG001674: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P59236 at UniProt or InterPro

Protein Sequence (176 amino acids)

>SO3081 Smr domain protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MNKDDDKEGMAMFSALIEGIKPITQDKRHFRTPLKTKQEIELKEQQLHANSYFSDTYQPL
LPVQGPMRWLDEGVDSLELKRLRRGDYQPDLLLDLHGYRQSEAKLELAALIQACVKQQSQ
CCCVMHGYGTGILKQQVPMWLVQHPMVKAFHQAPKEWGGDAALLVLIDIGDQPHRR