Protein Info for SO3080 in Shewanella oneidensis MR-1

Annotation: hemK family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 TIGR03533: protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific" amino acids 4 to 288 (285 residues), 435.1 bits, see alignment E=1.2e-134 TIGR00536: methyltransferase, HemK family" amino acids 6 to 296 (291 residues), 302.3 bits, see alignment E=2.9e-94 PF06325: PrmA" amino acids 124 to 200 (77 residues), 28.6 bits, see alignment E=3.7e-10 PF05175: MTS" amino acids 126 to 208 (83 residues), 51.3 bits, see alignment E=3.8e-17 PF09445: Methyltransf_15" amino acids 126 to 202 (77 residues), 29.4 bits, see alignment E=1.9e-10 PF13847: Methyltransf_31" amino acids 127 to 267 (141 residues), 32.9 bits, see alignment E=1.9e-11 PF13649: Methyltransf_25" amino acids 128 to 210 (83 residues), 34.9 bits, see alignment E=7.3e-12

Best Hits

Swiss-Prot: 100% identical to PRMB_SHEON: 50S ribosomal protein L3 glutamine methyltransferase (prmB) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K07320, putative adenine-specific DNA-methyltransferase [EC: 2.1.1.72] (inferred from 100% identity to son:SO_3080)

MetaCyc: 65% identical to ribosomal protein L3 N5-glutamine methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-1241 [EC: 2.1.1.298]

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmB, methylates LSU ribosomal protein L3p"

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.298 or 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ECQ4 at UniProt or InterPro

Protein Sequence (305 amino acids)

>SO3080 hemK family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MTELRTIGDMLRWAVSRFNDANVYYGHGTDNAWDEAIALVFHALHLPEEIGQQVILSNLT
SSEKHKIVELIIRRVRERLPVPYLTNKARFAGLEFYVDERVLVPRSPIAEMIANRFGPWL
YGKPVNRILDLCTGSGCIAIACAYEFDEAEVDALDISEDALDVAQVNVETLGVMDRVFPM
QSDLFSAIPEGPQYDLIVSNPPYVDEEDIGDMPDEYHHEPAIGLASGRDGLDLTKRILAN
AAQYLTPTGILVVEVGNSMVHLMEQFPEVPFTWVNFENGGDGVFVLTRDQLIEHQSLFAI
YRDAQ