Protein Info for SO3008 in Shewanella oneidensis MR-1
Annotation: hypothetical protein (NCBI ptt file)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.
Best Hits
KEGG orthology group: None (inferred from 100% identity to son:SO_3008)Predicted SEED Role
"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)
MetaCyc Pathways
- L-citrulline biosynthesis (7/8 steps found)
- L-glutamate and L-glutamine biosynthesis (6/7 steps found)
- ammonia assimilation cycle III (3/3 steps found)
- L-glutamate biosynthesis I (2/2 steps found)
- superpathway of L-citrulline metabolism (9/12 steps found)
- L-glutamine degradation I (1/1 steps found)
- L-glutamine degradation II (1/1 steps found)
- L-asparagine biosynthesis III (tRNA-dependent) (1/4 steps found)
- glutaminyl-tRNAgln biosynthesis via transamidation (1/4 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Glutamate metabolism
- Nitrogen metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.4.1.13
Use Curated BLAST to search for 1.4.1.13
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q8ECW4 at UniProt or InterPro
Protein Sequence (137 amino acids)
>SO3008 hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1) MITTKRRVLLDGNGSGQINVEGLGVYVPAIEHDHLKQKLMAEIQNLKDESNAYKVYLETA ASLSEQLKSITADREKLAAKLTKLDELASRFIEDSEEIAEFFDVMGGRNHLALAKDIRDI ADQMADLLNEQTAKGGE