Protein Info for SO2965 in Shewanella oneidensis MR-1

Annotation: prophage LambdaSo, portal protein, HK97 family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details TIGR01537: phage portal protein, HK97 family" amino acids 52 to 391 (340 residues), 299.2 bits, see alignment E=2e-93 PF04860: Phage_portal" amino acids 61 to 388 (328 residues), 318.3 bits, see alignment E=2.9e-99

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2965)

Predicted SEED Role

"Phage portal protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ED06 at UniProt or InterPro

Protein Sequence (432 amino acids)

>SO2965 prophage LambdaSo, portal protein,  HK97 family (NCBI ptt file) (Shewanella oneidensis MR-1)
MKQKNSLALVIAKAASQPFASLDSFMGKTLRLTDGDFWSQLMATSKSGKTVNVNTAMQLA
AVWACVRRISETVAMLPLGLYERQSDGGRIQVQNSLSTVLSIKPNADMTAMQFWEAVLAS
LLLKGNAFIEIHRSGGEIIALDFLMPHRMDIDLDDSGSLIYWYTPRNGSRRQIKKQNMMH
IPAFSLDGLIGLSTISYGANVFGGAMSAEDVSASTFKNGMTKTVAFKVDRVMNKEQRAEF
REYVKTITGAMNAGKSPVLEQGITPELIGINPIDAQLLESRNYSVEEICRWFLVDPSLIG
FGGKDSNWGTGLEQKMIGFVTLTLSSWIRRIEQSISINLLTPAQRQTQYAQYNLEALLRG
DSASRAEFYSKMTQNGIYTRDDCRVKENLPRRGGNADVLTVQTNLAPIDQLGAQSESAKV
QAALNNWLNQDN