Protein Info for SO2948 in Shewanella oneidensis MR-1

Annotation: prophage LambdaSo, tail assembly protein K, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF14464: Prok-JAB" amino acids 3 to 99 (97 residues), 62.8 bits, see alignment E=2.7e-21 PF00877: NLPC_P60" amino acids 118 to 233 (116 residues), 54.9 bits, see alignment E=7.5e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_2948)

Predicted SEED Role

"Phage tail assembly protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ED23 at UniProt or InterPro

Protein Sequence (237 amino acids)

>SO2948 prophage LambdaSo, tail assembly protein K, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MHQTILHAFSQHAASCYPNECCGLLIRQGNKAQYVKCENKATNKADEFVIDPQQYADIEE
LGAIIGICHSHPDASSKPSDRDRAMCEASGLPWHILSWPDGDLRTIVPTGERKSLLNRPF
VHGVWDCYSCVRDWYSEVQQIHLPDFARQDGWWEGEQELYLDNFAKAGFVALPNINLADL
QIGDVFLMQIQSQRVNHAAVYVGEGKILHHLYGRLSRYDIYGGYWQRNTRLIVRHCQ