Protein Info for SO2928 in Shewanella oneidensis MR-1

Annotation: acyl-CoA thioesterase I, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00657: Lipase_GDSL
  • amino acids 52 to 216 (165 residues), 79.7 bits, E=3.6e-26
• PF13472: Lipase_GDSL_2
  • amino acids 54 to 210 (157 residues), 98.3 bits, E=7.9e-32

Best Hits

Swiss-Prot: 46% identical to ESTE_VIBMI: Arylesterase from Vibrio mimicus

KEGG orthology group: K10804, acyl-CoA thioesterase I [EC: 3.1.1.5 3.1.2.-] (inferred from 100% identity to son:SO_2928)

Predicted SEED Role

"Arylesterase precursor (EC 3.1.1.2)" (EC 3.1.1.2)

MetaCyc Pathways

• phospholipid remodeling (phosphatidylethanolamine, yeast) (2/4 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.5, 3.1.2.-

Use Curated BLAST to search for 3.1.1.2 or 3.1.1.5 or 3.1.2.-

Sequence Analysis Tools

See Q8ED42 at UniProt or InterPro

Protein Sequence (227 amino acids)

>SO2928 acyl-CoA thioesterase I, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MALFFETTLDIGSFLYKSFLRQSHRCKPMAKALVICILLSLCVTTPVQAAKVLILGDSLG
ASYGMSEQLGWVALLQKNLPEHDFTNGSVSGETTAGGLRRLPALLDSVAPDLVVVELGGN
DGLRGFPPTQLKNNLTQIITLAKNSGAKVLLTEIMVPPNYGPRYTQKFTEVYQEIAKDED
IPLIPFFMQEIAPYPELMQRDGIHPNEKAQDKIANWMQPWIEKALTQ