Protein Info for SO2926 in Shewanella oneidensis MR-1

Annotation: ABC transporter, permease, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 835 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 34 to 37 (4 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details amino acids 345 to 365 (21 residues), see Phobius details amino acids 385 to 405 (21 residues), see Phobius details amino acids 411 to 434 (24 residues), see Phobius details amino acids 463 to 482 (20 residues), see Phobius details amino acids 708 to 728 (21 residues), see Phobius details amino acids 762 to 784 (23 residues), see Phobius details amino acids 797 to 817 (21 residues), see Phobius details PF02687: FtsX" amino acids 255 to 372 (118 residues), 34.4 bits, see alignment E=9.7e-13 amino acids 713 to 817 (105 residues), 43.4 bits, see alignment E=1.6e-15

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 100% identity to son:SO_2926)

Predicted SEED Role

"FIG00809136: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ED44 at UniProt or InterPro

Protein Sequence (835 amino acids)

>SO2926 ABC transporter, permease, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MELNLAWRLFKRELQQGQLLLIILAITLAVLSVSGLARVSERLQVAINGQATQFIAADRI
IDSPVQIDSTILAKADELGLKHVTNMQFNSMVYAGDQFQLVTVRAVESGYPLKGDIELKA
DNGQDVKAQGLPQADEIWFESRLGGLLGSPKTLELGNSEFSLSQEISRLPDAGFNPFASS
PVVLMRIEDVAKTGVIQPGSRVTYLYQFAGDETALTAFENSVKPLLNNTQRWVDVQSGDS
PIAGAVKRAERFLLLASLLGIALACAAIGIAAQRYCQRHYDVVAMLKTFGASSSQIRRLF
GIHLLLVTLFGIGLGLIGGALLDLGINQLLPPEIAAYSPPLTRPILLGISTGLISAFMFS
AYPLMRLLAIPPLRVLQRQLEGLQLGMWLHLLLSLGAMALLGYLYSQSWTLTLTVVAAVL
LLGVLLSLLGFVMIRLGHSVGMKTTNPLQLALAGLRRRARQNAVQLVGFSAALVLLLTIL
ALRQDLLNEWQKQLPENAPNYFLVNIAPDDAKPLNDFMAQKGIAATDIYPVIRGRLTQIN
GETLISNEQAEAGEKGRVGISRELNLTWRNALPANNELLEGQFNQAADEVSVESGVAERL
GVKLGDKLTYVIDNQELTVKVASIRAVHWETLQPNFFMIFTQEALAPFAYTSMASFYLDE
KGPNNTASGEGAPKNTVILELIQQFPTVSIIDVGAMVGQLRQIIEQVSLSLTLVLVLVLL
ASALVLIAQTEAGMATRQRELAVLRTFGASGWLLRSATGFEFALLGGIAGVLAVIVAEFA
LYLLKTQVFELNVYMHWPWWAIAPVSGALLVALLGVWRCRQLLNQSCAELLKAGS