Protein Info for SO2923 in Shewanella oneidensis MR-1

Name: gltS
Annotation: sodium/glutamate symporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 65 (24 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 96 to 120 (25 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 257 to 274 (18 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details amino acids 311 to 333 (23 residues), see Phobius details amino acids 345 to 366 (22 residues), see Phobius details amino acids 379 to 403 (25 residues), see Phobius details PF03616: Glt_symporter" amino acids 7 to 375 (369 residues), 456.5 bits, see alignment E=2.8e-141 TIGR00210: sodium/glutamate symporter" amino acids 10 to 406 (397 residues), 435.2 bits, see alignment E=1e-134

Best Hits

KEGG orthology group: K03312, glutamate:Na+ symporter, ESS family (inferred from 100% identity to son:SO_2923)

Predicted SEED Role

"Sodium/glutamate symport protein" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ED47 at UniProt or InterPro

Protein Sequence (407 amino acids)

>SO2923 sodium/glutamate symporter (NCBI ptt file) (Shewanella oneidensis MR-1)
MHTTYTIGELESFLIAIFVLFIGHSINRHVRVFKQYNIPEPIVGGLVVAAVIAFLHFQDI
TLAFSLPMQNTLMLMFFSTIGLSANYKLLLSGGKKVFIFLGVASVYIIIQNAVGVSLASL
LGLDPILGLIAGSITLSGGHGTGVAWSQTFAENYGINTLEFAMAAATFGLVMGGIIGGPV
AQRLISKHNLVSSYGVGRKHHATHPQLVTYDQLEEDQVTAKTIIETLFVLLFCVAGAKWF
TVLVSEYGLNWLKMPDFVYALFLGVVIANITEVTRGYKPHTESIDVIGTVALSLFLSMAL
MNLKLWEILDLAIPLLIILVVQTAVLAVFAYFVTFKVMGSNYDAAVITGGHCGFGMGATP
TAVMNMGALVSRTGPSPQAFMVVPIVGAFFIDIVNLIVLQGYLSFIM