Protein Info for SO2921 in Shewanella oneidensis MR-1

Name: folX
Annotation: D-erythro-7,8-dihydroneopterin triphosphate epimerase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 TIGR00526: FolB domain" amino acids 6 to 121 (116 residues), 103.8 bits, see alignment E=3.6e-34 PF02152: FolB" amino acids 8 to 116 (109 residues), 89.3 bits, see alignment E=1.3e-29

Best Hits

Swiss-Prot: 68% identical to FOLX_ECOL6: Dihydroneopterin triphosphate 2'-epimerase (folX) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07589, D-erythro-7,8-dihydroneopterin triphosphate epimerase [EC: 5.-.-.-] (inferred from 100% identity to son:SO_2921)

MetaCyc: 68% identical to dihydroneopterin triphosphate 2'-epimerase (Escherichia coli K-12 substr. MG1655)
H2NTPEPIM-RXN [EC: 5.1.99.7]

Predicted SEED Role

"Dihydroneopterin triphosphate epimerase" in subsystem Folate Biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-

Use Curated BLAST to search for 5.-.-.- or 5.1.99.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ED49 at UniProt or InterPro

Protein Sequence (122 amino acids)

>SO2921 D-erythro-7,8-dihydroneopterin triphosphate epimerase (NCBI ptt file) (Shewanella oneidensis MR-1)
MKPETAIIRIKNLRLRTFIGIKDDEIQNRQDVIVNVVIHYCAAKARNSDNVDDALNYRTI
TKKIIELIENNRFSLLENLTSQTLAIASEHPWVEFASVEIDKPHALRFADSVSMELCYQK
NQ