Protein Info for SO2913 in Shewanella oneidensis MR-1

Name: pflA
Annotation: pyruvate formate-lyase 1 activating enzyme (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02493: pyruvate formate-lyase 1-activating enzyme
  • amino acids 6 to 238 (233 residues), 354.9 bits, E=1.8e-110
• PF13353: Fer4_12
  • amino acids 16 to 142 (127 residues), 71.4 bits, E=1e-23
• PF04055: Radical_SAM
  • amino acids 26 to 181 (156 residues), 80.5 bits, E=1.7e-26

Best Hits

Swiss-Prot: 69% identical to PFLA_ECO57: Pyruvate formate-lyase 1-activating enzyme (pflA) from Escherichia coli O157:H7

KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 100% identity to son:SO_2913)

Predicted SEED Role

"Pyruvate formate-lyase activating enzyme (EC 1.97.1.4)" in subsystem Fermentations: Mixed acid or Threonine anaerobic catabolism gene cluster (EC 1.97.1.4)

MetaCyc Pathways

• mixed acid fermentation (15/16 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• pyruvate fermentation to ethanol I (3/3 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• superpathway of N-acetylneuraminate degradation (16/22 steps found)
• reductive monocarboxylic acid cycle (1/2 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (6/13 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Sequence Analysis Tools

See Q8ED57 at UniProt or InterPro

Protein Sequence (246 amino acids)

>SO2913 pyruvate formate-lyase 1 activating enzyme (NCBI ptt file) (Shewanella oneidensis MR-1)
MAVTGRIHSVESFGTVDGPGIRFIAFMQGCLMRCQYCHNRDTWDLDGGKEVQVDELMSQI
ISYRPFLDASNGGVTASGGEAILQAEFVAELFKACKKEGIHTCLDTNGFVRKYTPVIDEL
LDHTDLVLLDIKQMNDDKHIELTKVSNHRTLQFAEYLAKRNQPTWIRYVVVGGFTDDEAS
ALQLAEFIKPMKNIEKVELLPYHELGKHKWEAMGESYQLDGVAPPSRETMEKIKAVFSSQ
GINAVY