Protein Info for SO2909 in Shewanella oneidensis MR-1

Annotation: hypothetical ISSod6, transposase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 transmembrane" amino acids 231 to 250 (20 residues), see Phobius details PF13340: DUF4096" amino acids 6 to 77 (72 residues), 85.5 bits, see alignment E=6.2e-28 PF01609: DDE_Tnp_1" amino acids 89 to 247 (159 residues), 79.4 bits, see alignment E=8.2e-26 PF13359: DDE_Tnp_4" amino acids 117 to 245 (129 residues), 29.1 bits, see alignment E=1.7e-10 PF13612: DDE_Tnp_1_3" amino acids 121 to 224 (104 residues), 30.9 bits, see alignment E=6.4e-11 PF13586: DDE_Tnp_1_2" amino acids 163 to 248 (86 residues), 43.5 bits, see alignment E=9e-15

Best Hits

KEGG orthology group: None (inferred from 99% identity to son:SO_3272)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>SO2909 hypothetical ISSod6, transposase (NCBI ptt file) (Shewanella oneidensis MR-1)
MPRLMLTDARWEKLFHLMKSTGRVYDKPEHRQTFEGILYRLRTGIPWRDLPKEFGHWSTV
FRRFHLWSKKGVLAHLFKALANLADIEWVFIDGSIVRAHQHSAGAATLSNESIGKSRGGN
STKIHLAVDSGGLPIYFELSEGQKHDITHAPSLIEHLKQVDTVIADKGYDSDAFRELIAN
KGGKSVIPRRRYKNTPQERVDWCLYRYRHLVENAFGRIKHYRAISTRYDKLARNYASMVS
LAFMLMWLPMHC